TRIM60 Antikörper (N-Term)

Produktnummer ABIN631391

Produktdetails anti-TRIM60 Antikörper

Target: TRIM60 (Tripartite Motif Containing 60 (TRIM60))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM60 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRIM60 antibody was raised against the N terminal of TRIM60

Aufreinigung: Affinity purified

Immunogen: TRIM60 antibody was raised using the N terminal of TRIM60 corresponding to a region with amino acids LEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM60 Blocking Peptide, catalog no. 33R-4900, is also available for use as a blocking control in assays to test for specificity of this TRIM60 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM60 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM60

Target: TRIM60 (Tripartite Motif Containing 60 (TRIM60))

Andere Bezeichnung: TRIM60 (TRIM60 Produkte)

Synonyme: RNF129 antikoerper, RNF33 antikoerper, 2czf45 antikoerper, Rnf33 antikoerper, tripartite motif containing 60 antikoerper, tripartite motif-containing 60 antikoerper, TRIM60 antikoerper, Trim60 antikoerper

Hintergrund: TRIM60 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Molekulargewicht: 55 kDa (MW of target protein)