HECTD2 Antikörper (C-Term)

Produktnummer ABIN631394

Produktdetails anti-HECTD2 Antikörper

Target: HECTD2 (HECT Domain Containing 2 (HECTD2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HECTD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HECTD2 antibody was raised against the C terminal of HECTD2

Aufreinigung: Affinity purified

Immunogen: HECTD2 antibody was raised using the C terminal of HECTD2 corresponding to a region with amino acids TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HECTD2 Blocking Peptide, catalog no. 33R-9013, is also available for use as a blocking control in assays to test for specificity of this HECTD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HECTD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HECTD2

Target: HECTD2 (HECT Domain Containing 2 (HECTD2))

Andere Bezeichnung: HECTD2 (HECTD2 Produkte)

Synonyme: hmm77879 antikoerper, HECTD2 antikoerper, DKFZp459J1430 antikoerper, 4921524L07 antikoerper, A630025O09Rik antikoerper, AW212605 antikoerper, HECT domain E3 ubiquitin protein ligase 2 antikoerper, HECT domain containing E3 ubiquitin protein ligase 2 antikoerper, Probable E3 ubiquitin-protein ligase HECTD2 antikoerper, HECT domain containing 2 antikoerper, HECTD2 antikoerper, hectd2 antikoerper, hecd2 antikoerper, Hectd2 antikoerper

Hintergrund: HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Molekulargewicht: 88 kDa (MW of target protein)