HECTD2 Antikörper (C-Term)
-
- Target Alle HECTD2 Antikörper anzeigen
- HECTD2 (HECT Domain Containing 2 (HECTD2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HECTD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HECTD2 antibody was raised against the C terminal of HECTD2
- Aufreinigung
- Affinity purified
- Immunogen
- HECTD2 antibody was raised using the C terminal of HECTD2 corresponding to a region with amino acids TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET
- Top Product
- Discover our top product HECTD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HECTD2 Blocking Peptide, catalog no. 33R-9013, is also available for use as a blocking control in assays to test for specificity of this HECTD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HECTD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HECTD2 (HECT Domain Containing 2 (HECTD2))
- Andere Bezeichnung
- HECTD2 (HECTD2 Produkte)
- Hintergrund
- HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
- Molekulargewicht
- 88 kDa (MW of target protein)
-