RNF169 Antikörper (N-Term)

Produktnummer ABIN631397

Produktdetails anti-RNF169 Antikörper

Target: RNF169 (Ring Finger Protein 169 (RNF169))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF169 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF169 antibody was raised against the N terminal of RNF169

Aufreinigung: Affinity purified

Immunogen: RNF169 antibody was raised using the N terminal of RNF169 corresponding to a region with amino acids DTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF169 Blocking Peptide, catalog no. 33R-2192, is also available for use as a blocking control in assays to test for specificity of this RNF169 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF169 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF169

Target: RNF169 (Ring Finger Protein 169 (RNF169))

Andere Bezeichnung: RNF169 (RNF169 Produkte)

Synonyme: 2900057K09Rik antikoerper, ring finger protein 169 antikoerper, RNF169 antikoerper, Rnf169 antikoerper

Hintergrund: The function of RNF169 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 77 kDa (MW of target protein)