PNPLA5 Antikörper (C-Term)
-
- Target Alle PNPLA5 Antikörper anzeigen
- PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))
-
Bindungsspezifität
- C-Term
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PNPLA5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PNPLA5 antibody was raised against the C terminal of PNPLA5
- Aufreinigung
- Affinity purified
- Immunogen
- PNPLA5 antibody was raised using the C terminal of PNPLA5 corresponding to a region with amino acids NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA
- Top Product
- Discover our top product PNPLA5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PNPLA5 Blocking Peptide, catalog no. 33R-6789, is also available for use as a blocking control in assays to test for specificity of this PNPLA5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))
- Andere Bezeichnung
- PNPLA5 (PNPLA5 Produkte)
- Hintergrund
- Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.
- Molekulargewicht
- 48 kDa (MW of target protein)
-