PNPLA5 Antikörper (C-Term)

Produktnummer ABIN631400

Produktdetails anti-PNPLA5 Antikörper

Target: PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNPLA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PNPLA5 antibody was raised against the C terminal of PNPLA5

Aufreinigung: Affinity purified

Immunogen: PNPLA5 antibody was raised using the C terminal of PNPLA5 corresponding to a region with amino acids NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNPLA5 Blocking Peptide, catalog no. 33R-6789, is also available for use as a blocking control in assays to test for specificity of this PNPLA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNPLA5

Target: PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))

Andere Bezeichnung: PNPLA5 (PNPLA5 Produkte)

Synonyme: GS2L antikoerper, dJ388M5 antikoerper, dJ388M5.4 antikoerper, 4833426H19Rik antikoerper, patatin like phospholipase domain containing 5 antikoerper, patatin-like phospholipase domain containing 5 antikoerper, PNPLA5 antikoerper, Pnpla5 antikoerper

Hintergrund: Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.

Molekulargewicht: 48 kDa (MW of target protein)