VPS37A Antikörper
-
- Target Alle VPS37A Antikörper anzeigen
- VPS37A (Vacuolar Protein Sorting 37 Homolog A (VPS37A))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VPS37A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- VPS37 A antibody was raised using a synthetic peptide corresponding to a region with amino acids SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVE
- Top Product
- Discover our top product VPS37A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VPS37A Blocking Peptide, catalog no. 33R-8941, is also available for use as a blocking control in assays to test for specificity of this VPS37A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPS37A (Vacuolar Protein Sorting 37 Homolog A (VPS37A))
- Andere Bezeichnung
- VPS37A (VPS37A Produkte)
- Synonyme
- fb08f03 antikoerper, fj42c03 antikoerper, zgc:73244 antikoerper, zgc:77637 antikoerper, wu:fb08f03 antikoerper, wu:fj42c03 antikoerper, HCRP1 antikoerper, PQBP2 antikoerper, SPG53 antikoerper, 2210018P21Rik antikoerper, 4930592A21Rik antikoerper, AW261445 antikoerper, D8Ertd531e antikoerper, vacuolar protein sorting 37A antikoerper, VPS37A, ESCRT-I subunit antikoerper, vacuolar protein sorting 37 homolog A antikoerper, vacuolar protein sorting 37 homolog A L homeolog antikoerper, vps37a antikoerper, VPS37A antikoerper, vps37a.L antikoerper, Vps37a antikoerper
- Hintergrund
- VPS37A is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. VPS37A may be involved in cell growth and differentiation.
- Molekulargewicht
- 44 kDa (MW of target protein)
-