LDLRAP1 Antikörper (N-Term)
-
- Target Alle LDLRAP1 Antikörper anzeigen
- LDLRAP1 (Low Density Lipoprotein Receptor Adaptor Protein 1 (LDLRAP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LDLRAP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LDLRAP1 antibody was raised against the N terminal of LDLRAP1
- Aufreinigung
- Affinity purified
- Immunogen
- LDLRAP1 antibody was raised using the N terminal of LDLRAP1 corresponding to a region with amino acids WTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKK
- Top Product
- Discover our top product LDLRAP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LDLRAP1 Blocking Peptide, catalog no. 33R-10023, is also available for use as a blocking control in assays to test for specificity of this LDLRAP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDLRAP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9." in: Molecular genetics and metabolism, Vol. 99, Issue 2, pp. 149-56, (2010) (PubMed).
: "
-
A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9." in: Molecular genetics and metabolism, Vol. 99, Issue 2, pp. 149-56, (2010) (PubMed).
-
- Target
- LDLRAP1 (Low Density Lipoprotein Receptor Adaptor Protein 1 (LDLRAP1))
- Andere Bezeichnung
- LDLRAP1 (LDLRAP1 Produkte)
- Synonyme
- ARH antikoerper, ARH1 antikoerper, ARH2 antikoerper, FHCB1 antikoerper, FHCB2 antikoerper, AA691260 antikoerper, Arh antikoerper, Arh1 antikoerper, RGD1563417 antikoerper, arh antikoerper, arh1 antikoerper, arh2 antikoerper, fhcb1 antikoerper, fhcb2 antikoerper, xptb antikoerper, LDLRAP1 antikoerper, ldlrap1 antikoerper, sb:cb50 antikoerper, zgc:56121 antikoerper, zgc:158745 antikoerper, low density lipoprotein receptor adaptor protein 1 antikoerper, low density lipoprotein receptor adaptor protein 1 L homeolog antikoerper, low density lipoprotein receptor adaptor protein 1 S homeolog antikoerper, low density lipoprotein receptor adaptor protein 1a antikoerper, low density lipoprotein receptor adaptor protein 1b antikoerper, LDLRAP1 antikoerper, Ldlrap1 antikoerper, ldlrap1 antikoerper, ldlrap1.L antikoerper, ldlrap1.S antikoerper, ldlrap1a antikoerper, ldlrap1b antikoerper
- Hintergrund
- LDLRAP1 is an adapter protein (clathrin-associated sorting protein (CLASP)) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts). LDLRAP1 may be required for LDL binding and internalization but not for receptor clustering in coated pits. LDLRAP1 may facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-