ARCN1 Antikörper (Middle Region)

Produktnummer ABIN631413

Produktdetails anti-ARCN1 Antikörper

Target: ARCN1 (Archain 1 (ARCN1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARCN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Archain 1 antibody was raised against the middle region of ARCN1

Aufreinigung: Affinity purified

Immunogen: Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Archain 1 Blocking Peptide, catalog no. 33R-3292, is also available for use as a blocking control in assays to test for specificity of this Archain 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARCN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARCN1

Target: ARCN1 (Archain 1 (ARCN1))

Andere Bezeichnung: Archain 1 (ARCN1 Produkte)

Hintergrund: The gene that encodes ARCN1 maps in a region, which includes the mixed lineage leukemia and Friend leukemia virus integration 1 genes, where multiple disease-associated chromosome translocations occur. ARCN1 is an intracellular protein. Archain sequences are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking.

Molekulargewicht: 57 kDa (MW of target protein)