Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6) Antikörper
-
- Target Alle Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6) Antikörper anzeigen
- Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6)
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- HS3 ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP
- Top Product
- Discover our top product HS3ST6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HS3ST6 Blocking Peptide, catalog no. 33R-3249, is also available for use as a blocking control in assays to test for specificity of this HS3ST6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6)
- Andere Bezeichnung
- HS3ST6 (HS3ST6 Produkte)
- Hintergrund
- HS3ST6 is a single-pass type II membrane protein. It belongs to the sulfotransferase 1 family. It transfers a sulfuryl group to heparan sulfate. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes Simplex Virus-1 (HSV-1) and permits its entry. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-