Copine IV Antikörper (N-Term)
-
- Target Alle Copine IV (CPNE4) Antikörper anzeigen
- Copine IV (CPNE4)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Copine IV Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Copine IV antibody was raised against the N terminal of CPNE4
- Aufreinigung
- Affinity purified
- Immunogen
- Copine IV antibody was raised using the N terminal of CPNE4 corresponding to a region with amino acids EADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELSGNDDY
- Top Product
- Discover our top product CPNE4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Copine IV Blocking Peptide, catalog no. 33R-2252, is also available for use as a blocking control in assays to test for specificity of this Copine IV antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Copine IV (CPNE4)
- Andere Bezeichnung
- Copine IV (CPNE4 Produkte)
- Hintergrund
- Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm.
- Molekulargewicht
- 62 kDa (MW of target protein)
-