TNKS Antikörper (Middle Region)

Produktnummer ABIN631422

Produktdetails anti-TNKS Antikörper

Target: TNKS (Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNKS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TNKS antibody was raised against the middle region of TNKS

Aufreinigung: Affinity purified

Immunogen: TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TNKS Blocking Peptide, catalog no. 33R-5048, is also available for use as a blocking control in assays to test for specificity of this TNKS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNKS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TNKS

Target: TNKS (Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS))

Andere Bezeichnung: TNKS (TNKS Produkte)

Synonyme: wu:fe02c12 antikoerper, ARTD5 antikoerper, PARP-5a antikoerper, PARP5A antikoerper, PARPL antikoerper, TIN1 antikoerper, TINF1 antikoerper, TNKS1 antikoerper, pART5 antikoerper, 4930554K12Rik antikoerper, AI662855 antikoerper, C86528 antikoerper, D130072O21Rik antikoerper, TANK1 antikoerper, mTNKS1 antikoerper, tankyrase-1 antikoerper, tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase b antikoerper, tankyrase antikoerper, tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase antikoerper, tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 S homeolog antikoerper, tnksb antikoerper, TNKS antikoerper, Tnks antikoerper, tnks2.S antikoerper

Hintergrund: TNKS may regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. It has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.

Molekulargewicht: 142 kDa (MW of target protein)