GSTM5 Antikörper (N-Term)
-
- Target Alle GSTM5 Antikörper anzeigen
- GSTM5 (Glutathione S-Transferase mu 5 (GSTM5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GSTM5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GSTM5 antibody was raised against the N terminal of GSTM5
- Aufreinigung
- Affinity purified
- Immunogen
- GSTM5 antibody was raised using the N terminal of GSTM5 corresponding to a region with amino acids MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK
- Top Product
- Discover our top product GSTM5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GSTM5 Blocking Peptide, catalog no. 33R-6298, is also available for use as a blocking control in assays to test for specificity of this GSTM5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSTM5 (Glutathione S-Transferase mu 5 (GSTM5))
- Andere Bezeichnung
- GSTM5 (GSTM5 Produkte)
- Synonyme
- GSTM5-5 antikoerper, GTM5 antikoerper, glutathione S-transferase mu 5 antikoerper, glutathione S-transferase, mu 5 antikoerper, GSTM5 antikoerper, Gstm5 antikoerper
- Hintergrund
- Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.
- Molekulargewicht
- 26 kDa (MW of target protein)
-