B3GNT4 Antikörper (N-Term)

Produktnummer ABIN631426

Produktdetails anti-B3GNT4 Antikörper

Target: B3GNT4 (beta-1,3-N-Acetylglucosaminyltransferase 4 (B3GNT4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser B3GNT4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: B3 GNT4 antibody was raised against the N terminal of B3 NT4

Aufreinigung: Affinity purified

Immunogen: B3 GNT4 antibody was raised using the N terminal of B3 NT4 corresponding to a region with amino acids MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

B3GNT4 Blocking Peptide, catalog no. 33R-6200, is also available for use as a blocking control in assays to test for specificity of this B3GNT4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 NT4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu B3GNT4

Target: B3GNT4 (beta-1,3-N-Acetylglucosaminyltransferase 4 (B3GNT4))

Andere Bezeichnung: B3GNT4 (B3GNT4 Produkte)

Synonyme: B3GN-T4 antikoerper, beta3Gn-T4 antikoerper, 1010001G17Rik antikoerper, BGnT-4 antikoerper, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 antikoerper, B3GNT4 antikoerper, B3gnt4 antikoerper

Hintergrund: B3GNT4 is a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The protein is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein.

Molekulargewicht: 42 kDa (MW of target protein)