EXOC3 Antikörper (Middle Region)
-
- Target Alle EXOC3 Antikörper anzeigen
- EXOC3 (Exocyst Complex Component 3 (EXOC3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EXOC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EXOC3 antibody was raised against the middle region of EXOC3
- Aufreinigung
- Affinity purified
- Immunogen
- EXOC3 antibody was raised using the middle region of EXOC3 corresponding to a region with amino acids LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF
- Top Product
- Discover our top product EXOC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EXOC3 Blocking Peptide, catalog no. 33R-4927, is also available for use as a blocking control in assays to test for specificity of this EXOC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXOC3 (Exocyst Complex Component 3 (EXOC3))
- Andere Bezeichnung
- EXOC3 (EXOC3 Produkte)
- Synonyme
- CG5341 antikoerper, Dmel\\CG5341 antikoerper, Dsec6 antikoerper, Sec6 antikoerper, Sec6p antikoerper, dsec6 antikoerper, sec 6 antikoerper, F14O23.20 antikoerper, F14O23_20 antikoerper, sec6l1 antikoerper, fi26g09 antikoerper, wu:fi26g09 antikoerper, wu:fi34a09 antikoerper, wu:fj62h05 antikoerper, wu:fk66f08 antikoerper, zgc:55709 antikoerper, SEC6L1 antikoerper, SEC6 antikoerper, 2810050O03Rik antikoerper, E430013E20Rik antikoerper, Sec6l1 antikoerper, rSec6 antikoerper, Secretory 6 antikoerper, SEC6 antikoerper, exocyst complex component 3 antikoerper, Exocyst complex component 3 antikoerper, Sec6 antikoerper, SEC6 antikoerper, EXOC3 antikoerper, exoc3 antikoerper, Exoc3 antikoerper, sec-6 antikoerper
- Hintergrund
- EXOC3 is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery.
- Molekulargewicht
- 85 kDa (MW of target protein)
- Pathways
- Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis
-