Pallidin Antikörper
-
- Target Alle Pallidin (PLDN) Antikörper anzeigen
- Pallidin (PLDN) (Pallidin Homolog (PLDN))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Pallidin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids EGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTL
- Top Product
- Discover our top product PLDN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PLDN Blocking Peptide, catalog no. 33R-2437, is also available for use as a blocking control in assays to test for specificity of this PLDN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLDN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pallidin (PLDN) (Pallidin Homolog (PLDN))
- Andere Bezeichnung
- PLDN (PLDN Produkte)
- Synonyme
- CG14133 antikoerper, Dmel\\CG14133 antikoerper, LOC100226487 antikoerper, pldn antikoerper, BLOS6 antikoerper, HPS9 antikoerper, PA antikoerper, PALLID antikoerper, PLDN antikoerper, Pldn antikoerper, BLOC-1 antikoerper, Stx13bp1 antikoerper, pa antikoerper, pallidin antikoerper, CG14133 gene product from transcript CG14133-RB antikoerper, biogenesis of lysosomal organelles complex 1 subunit 6 antikoerper, pallidin homolog (mouse) antikoerper, biogenesis of lysosomal organelles complex-1, subunit 6, pallidin antikoerper, Pallidin antikoerper, BLOC1S6 antikoerper, pldn antikoerper, Bloc1s6 antikoerper
- Hintergrund
- PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.
- Molekulargewicht
- 20 kDa (MW of target protein)
- Pathways
- Synaptic Vesicle Exocytosis
-