Sec8 Antikörper (N-Term)

Produktnummer ABIN631432

Produktdetails anti-Sec8 Antikörper

Target: Sec8 (EXOC4) (Exocyst Complex Component 4 (EXOC4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Sec8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EXOC4 antibody was raised against the N terminal of EXOC4

Aufreinigung: Affinity purified

Immunogen: EXOC4 antibody was raised using the N terminal of EXOC4 corresponding to a region with amino acids MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOC4 Blocking Peptide, catalog no. 33R-5589, is also available for use as a blocking control in assays to test for specificity of this EXOC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Sec8

Target: Sec8 (EXOC4) (Exocyst Complex Component 4 (EXOC4))

Andere Bezeichnung: EXOC4 (EXOC4 Produkte)

Synonyme: CG2095 antikoerper, Dmel\\CG2095 antikoerper, Sec8 antikoerper, Sec8p antikoerper, dsec8 antikoerper, fun antikoerper, SEC8L1 antikoerper, DKFZp459N1430 antikoerper, SEC8 antikoerper, C78892 antikoerper, Sec8l1 antikoerper, ALR antikoerper, si:ch211-92l17.2 antikoerper, si:rp71-18a24.2 antikoerper, ATSEC8 antikoerper, SUBUNIT OF EXOCYST COMPLEX 8 antikoerper, subunit of exocyst complex 8 antikoerper, Secretory 8 antikoerper, exocyst complex component 4 antikoerper, exocyst complex component 4 L homeolog antikoerper, Exocyst complex component 4 antikoerper, subunit of exocyst complex 8 antikoerper, Sec8 antikoerper, EXOC4 antikoerper, CpipJ_CPIJ001354 antikoerper, Exoc4 antikoerper, exoc4 antikoerper, exoc4.L antikoerper, sec-8 antikoerper, SEC8 antikoerper

Hintergrund: The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis