RAB1A Antikörper (Middle Region)
-
- Target Alle RAB1A Antikörper anzeigen
- RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAB1A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RAB1 A antibody was raised against the middle region of RAB1
- Aufreinigung
- Affinity purified
- Immunogen
- RAB1 A antibody was raised using the middle region of RAB1 corresponding to a region with amino acids AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC
- Top Product
- Discover our top product RAB1A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAB1A Blocking Peptide, catalog no. 33R-1303, is also available for use as a blocking control in assays to test for specificity of this RAB1A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))
- Andere Bezeichnung
- RAB1A (RAB1A Produkte)
- Hintergrund
- This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms.
- Molekulargewicht
- 23 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-