ASL Antikörper (N-Term)

Produktnummer ABIN631440

Produktdetails anti-ASL Antikörper

Target: ASL (Argininosuccinate Lyase (ASL))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ASL antibody was raised against the N terminal of ASL

Aufreinigung: Affinity purified

Immunogen: ASL antibody was raised using the N terminal of ASL corresponding to a region with amino acids GATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASL Blocking Peptide, catalog no. 33R-3175, is also available for use as a blocking control in assays to test for specificity of this ASL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASL

Target: ASL (Argininosuccinate Lyase (ASL))

Andere Bezeichnung: ASL (ASL Produkte)

Synonyme: ASAL antikoerper, 2510006M18Rik antikoerper, zgc:63532 antikoerper, BA4879 antikoerper, PSPTO0125 antikoerper, Adl antikoerper, Asl antikoerper, argininosuccinate lyase antikoerper, argininosuccinate lyase ArgH antikoerper, adenylosuccinate lyase antikoerper, argininosuccinate lyase L homeolog antikoerper, ASL antikoerper, Asl antikoerper, asl antikoerper, argH2 antikoerper, argH antikoerper, arg7 antikoerper, CNC04420 antikoerper, STHERM_c13370 antikoerper, Adsl antikoerper, asl.L antikoerper, ARG7 antikoerper

Hintergrund: ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus