BAAT Antikörper (N-Term)

Produktnummer ABIN631444

Produktdetails anti-BAAT Antikörper

Target: BAAT (Bile Acid CoA: Amino Acid N-Acyltransferase (Glycine N-Choloyltransferase) (BAAT))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BAAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BAAT antibody was raised against the N terminal of BAAT

Aufreinigung: Affinity purified

Immunogen: BAAT antibody was raised using the N terminal of BAAT corresponding to a region with amino acids IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BAAT Blocking Peptide, catalog no. 33R-4118, is also available for use as a blocking control in assays to test for specificity of this BAAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BAAT

Target: BAAT (Bile Acid CoA: Amino Acid N-Acyltransferase (Glycine N-Choloyltransferase) (BAAT))

Andere Bezeichnung: BAAT (BAAT Produkte)

Synonyme: BACAT antikoerper, BAT antikoerper, AI118337 antikoerper, AI158864 antikoerper, kan-1 antikoerper, BAAT antikoerper, bile acid-CoA:amino acid N-acyltransferase antikoerper, Bile acid-CoA:amino acid N-acyltransferase antikoerper, bile acid-Coenzyme A: amino acid N-acyltransferase antikoerper, bile acid CoA:amino acid N-acyltransferase antikoerper, BAAT antikoerper, RPIC_RS10270 antikoerper, Bcav_2277 antikoerper, Rpic12D_1765 antikoerper, Baat antikoerper, LOC481635 antikoerper, LOC100054567 antikoerper, LOC786798 antikoerper

Hintergrund: BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA).

Molekulargewicht: 46 kDa (MW of target protein)