BAAT Antikörper (N-Term)
-
- Target Alle BAAT Antikörper anzeigen
- BAAT (Bile Acid CoA: Amino Acid N-Acyltransferase (Glycine N-Choloyltransferase) (BAAT))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BAAT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BAAT antibody was raised against the N terminal of BAAT
- Aufreinigung
- Affinity purified
- Immunogen
- BAAT antibody was raised using the N terminal of BAAT corresponding to a region with amino acids IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR
- Top Product
- Discover our top product BAAT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BAAT Blocking Peptide, catalog no. 33R-4118, is also available for use as a blocking control in assays to test for specificity of this BAAT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAAT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BAAT (Bile Acid CoA: Amino Acid N-Acyltransferase (Glycine N-Choloyltransferase) (BAAT))
- Andere Bezeichnung
- BAAT (BAAT Produkte)
- Hintergrund
- BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA).
- Molekulargewicht
- 46 kDa (MW of target protein)
-