Glycogen Synthase 2 Antikörper
-
- Target Alle Glycogen Synthase 2 (GYS2) Antikörper anzeigen
- Glycogen Synthase 2 (GYS2) (Glycogen Synthase 2, Liver (GYS2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Glycogen Synthase 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Glycogen Synthase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED
- Top Product
- Discover our top product GYS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Glycogen Synthase 2 Blocking Peptide, catalog no. 33R-9185, is also available for use as a blocking control in assays to test for specificity of this Glycogen Synthase 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GYS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glycogen Synthase 2 (GYS2) (Glycogen Synthase 2, Liver (GYS2))
- Andere Bezeichnung
- Glycogen Synthase 2 (GYS2 Produkte)
- Hintergrund
- GYS2 transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.
- Molekulargewicht
- 81 kDa (MW of target protein)
- Pathways
- AMPK Signaling, Cellular Glucan Metabolic Process
-