PARP9 Antikörper
-
- Target Alle PARP9 Antikörper anzeigen
- PARP9 (Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PARP9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PARP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI
- Top Product
- Discover our top product PARP9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PARP9 Blocking Peptide, catalog no. 33R-5013, is also available for use as a blocking control in assays to test for specificity of this PARP9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARP9 (Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9))
- Andere Bezeichnung
- PARP9 (PARP9 Produkte)
- Synonyme
- RGD1307534 antikoerper, ARTD9 antikoerper, BAL antikoerper, BAL1 antikoerper, MGC:7868 antikoerper, AW214463 antikoerper, BC003281 antikoerper, Bagl antikoerper, Bal antikoerper, PARP-9 antikoerper, poly (ADP-ribose) polymerase family, member 9 antikoerper, poly(ADP-ribose) polymerase family member 9 antikoerper, si:ch211-219a4.6 antikoerper, Parp9 antikoerper, PARP9 antikoerper, si:ch211-219a4.6 antikoerper
- Hintergrund
- PARP9 contains 2 Macro domains and 1 PARP catalytic domain. PARP9 is overexpressed at significantly higher levels in fatal high-risk diffuse large B-cell lymphomas (DLB-CL) compared to cured low-risk tumors. Overexpression of PARP9 in B-cell lymphoma transfectants may promote malignant B-cell migration. The function of PARP9 remains unknown.
- Molekulargewicht
- 96 kDa (MW of target protein)
-