ALG2 Antikörper

Produktnummer ABIN631449

Produktdetails anti-ALG2 Antikörper

Target: ALG2 (Asparagine-Linked Glycosylation 2, alpha-1,3-Mannosyltransferase Homolog (ALG2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ALG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALG2 Blocking Peptide, catalog no. 33R-7721, is also available for use as a blocking control in assays to test for specificity of this ALG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALG2

Target: ALG2 (Asparagine-Linked Glycosylation 2, alpha-1,3-Mannosyltransferase Homolog (ALG2))

Andere Bezeichnung: ALG2 (ALG2 Produkte)

Synonyme: CDGIi antikoerper, NET38 antikoerper, hALPG2 antikoerper, 1110018A23Rik antikoerper, 1300013N08Rik antikoerper, ALPG2 antikoerper, MNCb-5081 antikoerper, im:7145131 antikoerper, ALG2, alpha-1,3/1,6-mannosyltransferase antikoerper, asparagine-linked glycosylation 2 (alpha-1,3-mannosyltransferase) antikoerper, ALG2, alpha-1,3/1,6-mannosyltransferase L homeolog antikoerper, GDP-Man:Man(1)GlcNAc(2)-PP-dolichol alpha-1,3-mannosyltransferase antikoerper, ALG2 antikoerper, Alg2 antikoerper, alg2.L antikoerper, alg2 antikoerper

Hintergrund: ALG2 is a member of the glycosyltransferase 1 family. It acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).

Molekulargewicht: 47 kDa (MW of target protein)