Clavesin 1 Antikörper (Middle Region)

Produktnummer ABIN631450

Produktdetails anti-Clavesin 1 Antikörper

Target: Clavesin 1 (CLVS1)

Bindungsspezifität: Middle Region

Reaktivität: Ratte, Maus, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Clavesin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RLBP1 L1 antibody was raised against the middle region of RLBP1 1

Aufreinigung: Affinity purified

Immunogen: RLBP1 L1 antibody was raised using the middle region of RLBP1 1 corresponding to a region with amino acids MFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RLBP1L1 Blocking Peptide, catalog no. 33R-5996, is also available for use as a blocking control in assays to test for specificity of this RLBP1L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RLBP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Clavesin 1

Target: Clavesin 1 (CLVS1)

Andere Bezeichnung: RLBP1L1 (CLVS1 Produkte)

Synonyme: RLBP1L1 antikoerper, rlbp1l1 antikoerper, CRALBPL antikoerper, 4933402J24Rik antikoerper, Clvl1 antikoerper, Rlbp1l1 antikoerper, Clavesin-1 antikoerper, RGD1564200 antikoerper, clavesin 1 antikoerper, clavesin 1 L homeolog antikoerper, CLVS1 antikoerper, clvs1.L antikoerper, Clvs1 antikoerper

Hintergrund: RLBP1L1 contains 1 CRAL-TRIO domain. It may be used as a marker for human hepatocellular carcinomas.

Molekulargewicht: 41 kDa (MW of target protein)