GALE Antikörper (N-Term)
-
- Target Alle GALE Antikörper anzeigen
- GALE (UDP-Galactose-4-Epimerase (GALE))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GALE Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GALE antibody was raised against the N terminal of GALE
- Aufreinigung
- Affinity purified
- Immunogen
- GALE antibody was raised using the N terminal of GALE corresponding to a region with amino acids AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR
- Top Product
- Discover our top product GALE Primärantikörper
-
anti-UDP-Galactose-4-Epimerase (GALE) antibody
GALE Reaktivität: Human, Ratte, Hund, Affe WB, IHC, IHC (p) Wirt: Maus Monoclonal 1C4 unconjugated
anti-UDP-Galactose-4-Epimerase (GALE) (AA 1-340) antibodyGALE Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-UDP-Galactose-4-Epimerase (GALE) (AA 1-348) antibodyGALE Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-UDP-Galactose-4-Epimerase (GALE) (AA 142-171) antibodyGALE Reaktivität: Human WB, IF, IHC (p), FACS Wirt: Kaninchen Polyclonal RB21189 unconjugated
anti-UDP-Galactose-4-Epimerase (GALE) (AA 1-348) antibodyGALE Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-UDP-Galactose-4-Epimerase (GALE) (AA 1-348) antibodyGALE Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-UDP-Galactose-4-Epimerase (GALE) (AA 129-348) antibodyGALE Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-UDP-Galactose-4-Epimerase (GALE) antibodyGALE Reaktivität: Human, Maus, Ratte IF Wirt: Kaninchen Polyclonal unconjugated
anti-UDP-Galactose-4-Epimerase (GALE) (AA 201-250) antibodyGALE Reaktivität: Human, Hund, Rind (Kuh), Schwein, Kaninchen, Pferd, Fledermaus, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-UDP-Galactose-4-Epimerase (GALE) (N-Term) antibodyGALE Reaktivität: Human, Hund, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GALE Blocking Peptide, catalog no. 33R-1135, is also available for use as a blocking control in assays to test for specificity of this GALE antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALE antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALE (UDP-Galactose-4-Epimerase (GALE))
- Andere Bezeichnung
- GALE (GALE Produkte)
- Hintergrund
- GALE is an UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation.
- Molekulargewicht
- 38 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation, Cellular Glucan Metabolic Process
-
