ALOX15B Antikörper (N-Term)
-
- Target Alle ALOX15B Antikörper anzeigen
- ALOX15B (Arachidonate 15-Lipoxygenase B (ALOX15B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALOX15B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ALOX15 B antibody was raised against the N terminal of ALOX15
- Aufreinigung
- Affinity purified
- Immunogen
- ALOX15 B antibody was raised using the N terminal of ALOX15 corresponding to a region with amino acids MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE
- Top Product
- Discover our top product ALOX15B Primärantikörper
-
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 253-490) antibody
ALOX15B Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 349-633) antibodyALOX15B Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 1-200) antibodyALOX15B Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 181-280) antibodyALOX15B Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 4A7 unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 1-200) antibodyALOX15B Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 13-110) antibodyALOX15B Reaktivität: Ratte ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 597-627), (C-Term) antibodyALOX15B Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB17162 unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) antibodyALOX15B Reaktivität: Human, Maus WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 1-676) antibodyALOX15B Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 1-200) antibodyALOX15B Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALOX15B Blocking Peptide, catalog no. 33R-5636, is also available for use as a blocking control in assays to test for specificity of this ALOX15B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALOX15B (Arachidonate 15-Lipoxygenase B (ALOX15B))
- Andere Bezeichnung
- ALOX15B (ALOX15B Produkte)
- Synonyme
- 15-LOX-2 antikoerper, ALOX15B antikoerper, arachidonate 15-lipoxygenase, type B antikoerper, arachidonate 15-lipoxygenase B antikoerper, ALOX15B antikoerper, Alox15b antikoerper, LOC100525835 antikoerper
- Hintergrund
- ALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively.
- Molekulargewicht
- 67 kDa (MW of target protein)
-
