MYH10 Antikörper (N-Term)
-
- Target Alle MYH10 Antikörper anzeigen
- MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MYH10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MYH10 antibody was raised against the N terminal of MYH10
- Aufreinigung
- Affinity purified
- Immunogen
- MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD
- Top Product
- Discover our top product MYH10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MYH10 Blocking Peptide, catalog no. 33R-9945, is also available for use as a blocking control in assays to test for specificity of this MYH10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYH10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))
- Andere Bezeichnung
- MYH10 (MYH10 Produkte)
- Synonyme
- 5730504C04Rik antikoerper, 9330167F11Rik antikoerper, Fltn antikoerper, Myhn-2 antikoerper, Myhn2 antikoerper, NMHC II-B antikoerper, NMHC-B antikoerper, NMHCII-B antikoerper, NMMHC II-b antikoerper, NMMHC-B antikoerper, NMMHC-IIB antikoerper, SMemb antikoerper, mKIAA3005 antikoerper, MCH-B antikoerper, nmmhcb antikoerper, myosin antikoerper, myosin-10 antikoerper, non-muscle antikoerper, NMMHCB antikoerper, dZ204D19.2 antikoerper, si:dz150i12.3 antikoerper, wu:fc46h07 antikoerper, wu:fy19d11 antikoerper, myosin, heavy polypeptide 10, non-muscle antikoerper, myosin heavy chain 10 antikoerper, myosin, heavy chain 10, non-muscle S homeolog antikoerper, myosin, heavy chain 10, non-muscle antikoerper, Myh10 antikoerper, myh10.S antikoerper, MYH10 antikoerper, myh10 antikoerper
- Hintergrund
- MYH10 is the cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.
- Molekulargewicht
- 229 kDa (MW of target protein)
-