OSBPL9 Antikörper (N-Term)

Produktnummer ABIN631464

Produktdetails anti-OSBPL9 Antikörper

Target: OSBPL9 (Oxysterol Binding Protein-Like 9 (OSBPL9))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OSBPL9 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Spezifität: OSBPL9 antibody was raised against the N terminal of OSBPL9

Aufreinigung: Affinity purified

Immunogen: OSBPL9 antibody was raised using the N terminal of OSBPL9 corresponding to a region with amino acids HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OSBPL9 Blocking Peptide, catalog no. 33R-3831, is also available for use as a blocking control in assays to test for specificity of this OSBPL9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OSBPL9

Target: OSBPL9 (Oxysterol Binding Protein-Like 9 (OSBPL9))

Andere Bezeichnung: OSBPL9 (OSBPL9 Produkte)

Synonyme: OSBPL9 antikoerper, osbpl9 antikoerper, MGC145585 antikoerper, ORP-9 antikoerper, DKFZp469M1123 antikoerper, ORP9 antikoerper, zgc:154069 antikoerper, 2600011I06Rik antikoerper, AU015843 antikoerper, Orp-9 antikoerper, oxysterol binding protein-like 9 antikoerper, oxysterol binding protein like 9 antikoerper, oxysterol-binding protein-related protein 9 antikoerper, oxysterol binding protein like 9 L homeolog antikoerper, Osbpl9 antikoerper, OSBPL9 antikoerper, Tsp_05293 antikoerper, LOC578365 antikoerper, osbpl9 antikoerper, osbpl9.L antikoerper

Hintergrund: OSBPL9 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain.

Molekulargewicht: 61 kDa (MW of target protein)