OSBPL9 Antikörper (N-Term)
-
- Target Alle OSBPL9 Antikörper anzeigen
- OSBPL9 (Oxysterol Binding Protein-Like 9 (OSBPL9))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OSBPL9 Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Spezifität
- OSBPL9 antibody was raised against the N terminal of OSBPL9
- Aufreinigung
- Affinity purified
- Immunogen
- OSBPL9 antibody was raised using the N terminal of OSBPL9 corresponding to a region with amino acids HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE
- Top Product
- Discover our top product OSBPL9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OSBPL9 Blocking Peptide, catalog no. 33R-3831, is also available for use as a blocking control in assays to test for specificity of this OSBPL9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OSBPL9 (Oxysterol Binding Protein-Like 9 (OSBPL9))
- Andere Bezeichnung
- OSBPL9 (OSBPL9 Produkte)
- Hintergrund
- OSBPL9 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain.
- Molekulargewicht
- 61 kDa (MW of target protein)
-