METAP2 Antikörper (N-Term)
-
- Target Alle METAP2 Antikörper anzeigen
- METAP2 (Methionyl Aminopeptidase 2 (METAP2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser METAP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- METAP2 antibody was raised against the N terminal of METAP2
- Aufreinigung
- Affinity purified
- Immunogen
- METAP2 antibody was raised using the N terminal of METAP2 corresponding to a region with amino acids ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR
- Top Product
- Discover our top product METAP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
METAP2 Blocking Peptide, catalog no. 33R-1556, is also available for use as a blocking control in assays to test for specificity of this METAP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METAP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- METAP2 (Methionyl Aminopeptidase 2 (METAP2))
- Andere Bezeichnung
- METAP2 (METAP2 Produkte)
- Synonyme
- metap2 antikoerper, MGC53792 antikoerper, METAP2 antikoerper, GB13458 antikoerper, DDBDRAFT_0190923 antikoerper, DDBDRAFT_0304991 antikoerper, DDB_0190923 antikoerper, DDB_0304991 antikoerper, 4930584B20Rik antikoerper, A930035J23Rik antikoerper, AI047573 antikoerper, AL024412 antikoerper, AU014659 antikoerper, Amp2 antikoerper, Mnpep antikoerper, p67 antikoerper, p67eIF2 antikoerper, MAP2 antikoerper, MNPEP antikoerper, wu:fb98h06 antikoerper, zgc:66250 antikoerper, methionyl aminopeptidase 2 L homeolog antikoerper, methionyl aminopeptidase 2 antikoerper, methionine aminopeptidase 2 antikoerper, methionine aminopeptidase antikoerper, methionyl aminopeptidase 2 S homeolog antikoerper, methionyl aminopeptidase 2b antikoerper, metap2.L antikoerper, METAP2 antikoerper, metap2 antikoerper, LOC551771 antikoerper, CAALFM_C604080WA antikoerper, Metap2 antikoerper, metap2.S antikoerper, metap2b antikoerper
- Hintergrund
- METAP2 is a member of the methionyl aminopeptidase family and encodes a protein that binds 2 cobalt or manganese ions. This protein functions both by protecting the alpha subunit of eukaryotic initiation factor 2 from inhibitory phosphorylation and by removing the amino-terminal methionine residue from nascent protein. Increased expression of this gene is associated with various forms of cancer and the anti-cancer drugs fumagillin and ovalicin inhibit the protein by irreversibly binding to its active site.
- Molekulargewicht
- 53 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling
-