COG2 Antikörper (N-Term)

Produktnummer ABIN631472

Produktdetails anti-COG2 Antikörper

Target: COG2 (Conserved oligomeric Golgi complex subunit 2 (COG2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: COG2 antibody was raised against the N terminal of COG2

Aufreinigung: Affinity purified

Immunogen: COG2 antibody was raised using the N terminal of COG2 corresponding to a region with amino acids KRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COG2 Blocking Peptide, catalog no. 33R-4640, is also available for use as a blocking control in assays to test for specificity of this COG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COG2

Target: COG2 (Conserved oligomeric Golgi complex subunit 2 (COG2))

Andere Bezeichnung: COG2 (COG2 Produkte)

Synonyme: zC8A9.2 antikoerper, zgc:56436 antikoerper, LDLC antikoerper, 1190002B08Rik antikoerper, 2700012E02Rik antikoerper, C86089 antikoerper, Ldlc antikoerper, component of oligomeric golgi complex 2 antikoerper, cog2 antikoerper, COG2 antikoerper, Cog2 antikoerper

Hintergrund: Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG2.

Molekulargewicht: 83 kDa (MW of target protein)