CDC42EP4 Antikörper
-
- Target Alle CDC42EP4 Antikörper anzeigen
- CDC42EP4 (CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDC42EP4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CDC42 EP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ
- Top Product
- Discover our top product CDC42EP4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDC42EP4 Blocking Peptide, catalog no. 33R-8850, is also available for use as a blocking control in assays to test for specificity of this CDC42EP4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC40 P4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDC42EP4 (CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4))
- Andere Bezeichnung
- CDC42EP4 (CDC42EP4 Produkte)
- Synonyme
- cdc42ep4 antikoerper, zgc:91889 antikoerper, wu:fb55a05 antikoerper, cep4 antikoerper, borg4 antikoerper, kaia1777 antikoerper, BORG4 antikoerper, CEP4 antikoerper, KAIA1777 antikoerper, 1500041M20Rik antikoerper, Borg4 antikoerper, CDC42 effector protein 4 antikoerper, CDC42 effector protein (Rho GTPase binding) 4a antikoerper, CDC42 effector protein 4 L homeolog antikoerper, CDC42 effector protein (Rho GTPase binding) 4 antikoerper, CDC42EP4 antikoerper, cdc42ep4a antikoerper, cdc42ep4 antikoerper, cdc42ep4.L antikoerper, Cdc42ep4 antikoerper
- Hintergrund
- CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.
- Molekulargewicht
- 38 kDa (MW of target protein)
-