MYO1E Antikörper (Middle Region)
-
- Target Alle MYO1E Antikörper anzeigen
- MYO1E (Myosin IE (MYO1E))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MYO1E Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Myosin Ie antibody was raised against the middle region of MYO1 E
- Aufreinigung
- Affinity purified
- Immunogen
- Myosin Ie antibody was raised using the middle region of MYO1 E corresponding to a region with amino acids PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR
- Top Product
- Discover our top product MYO1E Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Myosin Ie Blocking Peptide, catalog no. 33R-7176, is also available for use as a blocking control in assays to test for specificity of this Myosin Ie antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYO0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MYO1E (Myosin IE (MYO1E))
- Andere Bezeichnung
- Myosin Ie (MYO1E Produkte)
- Synonyme
- FSGS6 antikoerper, HuncM-IC antikoerper, MYO1C antikoerper, MYR5 antikoerper, Myr3 antikoerper, 2310020N23Rik antikoerper, 9130023P14Rik antikoerper, AA407778 antikoerper, myosin-1e antikoerper, myr 3 antikoerper, myo1e antikoerper, wu:fc15g04 antikoerper, wu:fe49h01 antikoerper, myosin IE antikoerper, myosin IE, a antikoerper, MYO1E antikoerper, Myo1e antikoerper, myo1ea antikoerper
- Hintergrund
- Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments.
- Molekulargewicht
- 127 kDa (MW of target protein)
- Pathways
- Platelet-derived growth Factor Receptor Signaling
-