LAP3 Antikörper (N-Term)
-
- Target Alle LAP3 Antikörper anzeigen
- LAP3 (Cytosol Aminopeptidase (LAP3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LAP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LAP3 antibody was raised against the N terminal of LAP3
- Aufreinigung
- Affinity purified
- Immunogen
- LAP3 antibody was raised using the N terminal of LAP3 corresponding to a region with amino acids LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN
- Top Product
- Discover our top product LAP3 Primärantikörper
-
anti-Cytosol Aminopeptidase (LAP3) (AA 420-519) antibody
LAP3 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Cytosol Aminopeptidase (LAP3) (AA 89-119), (N-Term) antibodyLAP3 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB14573 unconjugated
anti-Cytosol Aminopeptidase (LAP3) (AA 1-519) antibodyLAP3 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Cytosol Aminopeptidase (LAP3) (AA 1-519) antibodyLAP3 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Cytosol Aminopeptidase (LAP3) (AA 420-519) antibodyLAP3 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4G10 unconjugated
anti-Cytosol Aminopeptidase (LAP3) (N-Term) antibodyLAP3 Reaktivität: Human, Maus, Ratte, Kaninchen, Hund, Pferd, Rind (Kuh), Meerschweinchen, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Cytosol Aminopeptidase (LAP3) antibodyLAP3 Reaktivität: Human, Maus, Ratte IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Cytosol Aminopeptidase (LAP3) (AA 260-519) antibodyLAP3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Cytosol Aminopeptidase (LAP3) (AA 133-182) antibodyLAP3 Reaktivität: Human, Maus, Ratte, Kaninchen, Hund, Pferd, Zebrafisch (Danio rerio), Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Cytosol Aminopeptidase (LAP3) (AA 71-120) antibodyLAP3 Reaktivität: Human, Maus, Ratte, Kaninchen, Hund, Pferd, Rind (Kuh), Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LAP3 Blocking Peptide, catalog no. 33R-5225, is also available for use as a blocking control in assays to test for specificity of this LAP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAP3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LAP3 (Cytosol Aminopeptidase (LAP3))
- Andere Bezeichnung
- LAP3 (LAP3 Produkte)
- Synonyme
- LAP antikoerper, LAPEP antikoerper, PEPS antikoerper, 2410015L10Rik antikoerper, AA410100 antikoerper, LAP-3 antikoerper, Lap antikoerper, Lapep antikoerper, Pep-7 antikoerper, Pep-S antikoerper, Pep7 antikoerper, Peps antikoerper, cytosol aminopeptidase antikoerper, leucine aminopeptidase 3 antikoerper, pepA antikoerper, Plabr_1567 antikoerper, Dester_0800 antikoerper, Weevi_0186 antikoerper, Marky_0570 antikoerper, Halhy_2623 antikoerper, FsymDg_3217 antikoerper, Flexsi_2186 antikoerper, Runsl_3980 antikoerper, lap3 antikoerper, LAP3 antikoerper, Lap3 antikoerper
- Hintergrund
- LAP3 is presumably involved in the processing and regular turnover of intracellular proteins. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.
- Molekulargewicht
- 56 kDa (MW of target protein)
-
