beta Tubulin 2A (N-Term) Antikörper

Produktnummer ABIN631483

Produktdetails

Target: beta Tubulin 2A

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Beta Tubulin 2 A antibody was raised against the N terminal of TUBB2

Aufreinigung: Affinity purified

Immunogen: Beta Tubulin 2 A antibody was raised using the N terminal of TUBB2 corresponding to a region with amino acids MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Beta Tubulin 2A Blocking Peptide, catalog no. 33R-5679, is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin 2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: beta Tubulin 2A

Hintergrund: TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Molekulargewicht: 50 kDa (MW of target protein)