TUBA4A Antikörper (Middle Region)

Produktnummer ABIN631484

Produktdetails anti-TUBA4A Antikörper

Target: TUBA4A (Tubulin, alpha 4a (TUBA4A))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster, Arabidopsis, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUBA4A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Alpha Tubulin 4 A antibody was raised against the middle region of TUBA4

Aufreinigung: Affinity purified

Immunogen: alpha Tubulin 4 A antibody was raised using the middle region of TUBA4 corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

alpha Tubulin 4A Blocking Peptide, catalog no. 33R-3301, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 4A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUBA4A

Target: TUBA4A (Tubulin, alpha 4a (TUBA4A))

Andere Bezeichnung: alpha Tubulin 4A (TUBA4A Produkte)

Hintergrund: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Microtubule Dynamics, M Phase