PCYT2 Antikörper (Middle Region)
-
- Target Alle PCYT2 Antikörper anzeigen
- PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PCYT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PCYT2 antibody was raised against the middle region of PCYT2
- Aufreinigung
- Affinity purified
- Immunogen
- PCYT2 antibody was raised using the middle region of PCYT2 corresponding to a region with amino acids KCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIG
- Top Product
- Discover our top product PCYT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCYT2 Blocking Peptide, catalog no. 33R-4274, is also available for use as a blocking control in assays to test for specificity of this PCYT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCYT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))
- Andere Bezeichnung
- PCYT2 (PCYT2 Produkte)
- Synonyme
- ET antikoerper, 1110033E03Rik antikoerper, ethanolamine-phosphate cytidylyltransferase antikoerper, putative ethanolamine-phosphate cytidylyltransferase antikoerper, Ethanolamine-phosphate cytidylyltransferase antikoerper, phosphate cytidylyltransferase 2, ethanolamine antikoerper, phosphate cytidylyltransferase 2, ethanolamine L homeolog antikoerper, Tc00.1047053511727.120 antikoerper, Tb11.01.5730 antikoerper, LINJ_32_0940 antikoerper, LOC5566800 antikoerper, LMJF_32_0890 antikoerper, EDI_013070 antikoerper, EDI_204270 antikoerper, CpipJ_CPIJ009320 antikoerper, Bm1_01855 antikoerper, pcy2 antikoerper, PCYT2 antikoerper, Pcyt2 antikoerper, pcyt2.L antikoerper
- Hintergrund
- PCYT2 is an enzyme that catalyzes the formation of CDP-ethanolamine from CTP and phosphoethanolamine in the Kennedy pathway of phospholipid synthesis. Alternative splicing results in multiple transcript variants.
- Molekulargewicht
- 44 kDa (MW of target protein)
-