Calicin Antikörper (C-Term)
-
- Target Alle Calicin (CCIN) Antikörper anzeigen
- Calicin (CCIN)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Calicin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Calicin antibody was raised against the C terminal of CCIN
- Aufreinigung
- Affinity purified
- Immunogen
- Calicin antibody was raised using the C terminal of CCIN corresponding to a region with amino acids TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA
- Top Product
- Discover our top product CCIN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Calicin Blocking Peptide, catalog no. 33R-9333, is also available for use as a blocking control in assays to test for specificity of this Calicin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCIN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Calicin (CCIN)
- Andere Bezeichnung
- Calicin (CCIN Produkte)
- Hintergrund
- CCIN is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation.
- Molekulargewicht
- 65 kDa (MW of target protein)
-