GID4 Antikörper (C-Term)
-
- Target Alle GID4 Antikörper anzeigen
- GID4 (GID Complex Subunit 4, VID24 Homolog (GID4))
- Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GID4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C17 ORF39 antibody was raised against the C terminal Of C17 rf39
- Aufreinigung
- Affinity purified
- Immunogen
- C17 ORF39 antibody was raised using the C terminal Of C17 rf39 corresponding to a region with amino acids WDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFL
- Top Product
- Discover our top product GID4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C17ORF39 Blocking Peptide, catalog no. 33R-9936, is also available for use as a blocking control in assays to test for specificity of this C17ORF39 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF39 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GID4 (GID Complex Subunit 4, VID24 Homolog (GID4))
- Andere Bezeichnung
- C17ORF39 (GID4 Produkte)
- Synonyme
- C17orf39 antikoerper, VID24 antikoerper, 4933439F18Rik antikoerper, GID complex subunit 4 homolog antikoerper, GID complex subunit 4, VID24 homolog antikoerper, GID4 antikoerper, Gid4 antikoerper
- Hintergrund
- The function of C17orf39 protein has not been widely studied, and is yet to be fully elucidated. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors.
- Molekulargewicht
- 33 kDa (MW of target protein)
-