PAOX Antikörper
-
- Target Alle PAOX Antikörper anzeigen
- PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PAOX Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids LCLTQVLRRVTGNPRLPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGGDLD
- Top Product
- Discover our top product PAOX Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PAOX Blocking Peptide, catalog no. 33R-4825, is also available for use as a blocking control in assays to test for specificity of this PAOX antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAOX antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))
- Andere Bezeichnung
- PAOX (PAOX Produkte)
- Synonyme
- PAO antikoerper, mpao1 antikoerper, 2410012F02Rik antikoerper, AI118225 antikoerper, Pao antikoerper, pao antikoerper, polyamine oxidase antikoerper, polyamine oxidase 1 antikoerper, amine oxidase family protein antikoerper, si:dkey-275b16.2 antikoerper, polyamine oxidase (exo-N4-amino) antikoerper, polyamine oxidase (exo-N4-amino) L homeolog antikoerper, PAOX antikoerper, pao1 antikoerper, NFIA_077590 antikoerper, POPTR_0011s12590g antikoerper, si:dkey-275b16.2 antikoerper, Paox antikoerper, paox.L antikoerper
- Hintergrund
- PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.
- Molekulargewicht
- 25 kDa (MW of target protein)
-