Cytokeratin 7 Antikörper (N-Term)
-
- Target Alle Cytokeratin 7 (KRT7) Antikörper anzeigen
- Cytokeratin 7 (KRT7) (Keratin 7 (KRT7))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cytokeratin 7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cytokeratin 7 antibody was raised against the N terminal of KRT7
- Aufreinigung
- Affinity purified
- Immunogen
- Cytokeratin 7 antibody was raised using the N terminal of KRT7 corresponding to a region with amino acids SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV
- Top Product
- Discover our top product KRT7 Primärantikörper
-
anti-Keratin 7 (KRT7) (AA 251-350) antibody
KRT7 Reaktivität: Human, Maus WB, FACS, IHC (p), ELISA, IHC (fro), IF (cc), IF (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Keratin 7 (KRT7) (AA 91-394) antibodyKRT7 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Keratin 7 (KRT7) (AA 394-457) antibodyKRT7 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Keratin 7 (KRT7) (AA 1-94) antibodyKRT7 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Keratin 7 (KRT7) (AA 2-469) antibodyKRT7 Reaktivität: Human WB, IHC, IF, ELISA, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Keratin 7 (KRT7) antibodyKRT7 Reaktivität: Human WB, IHC, FACS, StM Wirt: Maus Monoclonal rOV-TL12-30 unconjugated Recombinant Antibody
anti-Keratin 7 (KRT7) antibodyKRT7 Reaktivität: Human, Ratte IHC, IF, FACS, StM Wirt: Maus Monoclonal KRT7-760-OV-TL12-30 unconjugated
anti-Keratin 7 (KRT7) antibodyKRT7 Reaktivität: Human IHC, IF, FACS, StM Wirt: Maus Monoclonal KRT7-903 unconjugated
anti-Keratin 7 (KRT7) antibodyKRT7 Reaktivität: Human WB, IHC, FACS, StM, ISt Wirt: Kaninchen Monoclonal KRT7-1499R unconjugated
anti-Keratin 7 (KRT7) antibodyKRT7 Reaktivität: Human WB, IHC, IF, ELISA, IP Wirt: Maus Monoclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cytokeratin 7 Blocking Peptide, catalog no. 33R-8529, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cytokeratin 7 (KRT7) (Keratin 7 (KRT7))
- Andere Bezeichnung
- Cytokeratin 7 (KRT7 Produkte)
- Synonyme
- CK7 antikoerper, K2C7 antikoerper, K7 antikoerper, SCL antikoerper, D15Wsu77e antikoerper, Krt2-7 antikoerper, KRT7 antikoerper, keratin 7 antikoerper, KRT7 antikoerper, Krt7 antikoerper
- Hintergrund
- KRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13.
- Molekulargewicht
- 52 kDa (MW of target protein)
-
