POLR1B Antikörper
-
- Target Alle POLR1B Antikörper anzeigen
- POLR1B (Polymerase (RNA) I Polypeptide B, 128kDa (POLR1B))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser POLR1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- POLR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD
- Top Product
- Discover our top product POLR1B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
POLR1B Blocking Peptide, catalog no. 33R-8358, is also available for use as a blocking control in assays to test for specificity of this POLR1B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLR1B (Polymerase (RNA) I Polypeptide B, 128kDa (POLR1B))
- Andere Bezeichnung
- POLR1B (POLR1B Produkte)
- Synonyme
- RPOL-1l antikoerper, MGC68946 antikoerper, 128kDa antikoerper, D630020H17Rik antikoerper, RPA116 antikoerper, RPA135 antikoerper, RPA2 antikoerper, Rpo1-2 antikoerper, RNA polymerase I subunit B antikoerper, polymerase (RNA) I polypeptide B L homeolog antikoerper, polymerase (RNA) I polypeptide B, 128kDa antikoerper, polymerase (RNA) I polypeptide B antikoerper, DNA-directed RNA polymerase I subunit RPA2 antikoerper, POLR1B antikoerper, polr1b.L antikoerper, polr1b antikoerper, LOC100563266 antikoerper, LOC100634236 antikoerper, Polr1b antikoerper
- Hintergrund
- Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species.
- Molekulargewicht
- 128 kDa (MW of target protein)
-