NAT9 Antikörper

Produktnummer ABIN631510

Produktdetails anti-NAT9 Antikörper

Target: NAT9 (N-Acetyltransferase 9 (NAT9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NAT9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NAT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NAT9 Blocking Peptide, catalog no. 33R-6370, is also available for use as a blocking control in assays to test for specificity of this NAT9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NAT9

Target: NAT9 (N-Acetyltransferase 9 (NAT9))

Andere Bezeichnung: NAT9 (NAT9 Produkte)

Synonyme: EBSP, hNATL antikoerper, 1110028N05Rik antikoerper, N-acetyltransferase 9 (putative) antikoerper, N-acetyltransferase 9 (GCN5-related, putative) antikoerper, NAT9 antikoerper, Nat9 antikoerper

Hintergrund: N-acetyltransferase 9 is an enzyme that in humans is encoded by the NAT9 gene.

Molekulargewicht: 23 kDa (MW of target protein)