DDT Antikörper (N-Term)

Produktnummer ABIN631517

Produktdetails anti-DDT Antikörper

Target: DDT (D-Dopachrome Tautomerase (DDT))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DDT antibody was raised against the N terminal of DDT

Aufreinigung: Affinity purified

Immunogen: DDT antibody was raised using the N terminal of DDT corresponding to a region with amino acids PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDT Blocking Peptide, catalog no. 33R-7078, is also available for use as a blocking control in assays to test for specificity of this DDT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDT

Target: DDT (D-Dopachrome Tautomerase (DDT))

Andere Bezeichnung: DDT (DDT Produkte)

Synonyme: ddt-b antikoerper, zgc:86714 antikoerper, wu:fb49f11 antikoerper, C78655 antikoerper, DDT antikoerper, ddt antikoerper, ddt-a antikoerper, DDCT antikoerper, D-dopachrome tautomerase L homeolog antikoerper, D-dopachrome tautomerase antikoerper, D-dopachrome tautomerase S homeolog antikoerper, ddt.L antikoerper, DDT antikoerper, ddt antikoerper, Ddt antikoerper, ddt.S antikoerper

Hintergrund: D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. It is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.

Molekulargewicht: 13 kDa (MW of target protein)