KRT23 Antikörper

Produktnummer ABIN631521

Produktdetails anti-KRT23 Antikörper

Target: KRT23 (Keratin 23 (KRT23))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRT23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Cytokeratin 23 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cytokeratin 23 Blocking Peptide, catalog no. 33R-4032, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KRT23

Target: KRT23 (Keratin 23 (KRT23))

Andere Bezeichnung: Cytokeratin 23 (KRT23 Produkte)

Synonyme: CK23 antikoerper, HAIK1 antikoerper, K23 antikoerper, Haik1 antikoerper, Krt1-23 antikoerper, Ka23 antikoerper, keratin 23 antikoerper, type II keratin 23 antikoerper, KRT23 antikoerper, Krt23 antikoerper, Kb23 antikoerper

Hintergrund: KRT23 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains.

Molekulargewicht: 48 kDa (MW of target protein)