PPP2R5A Antikörper (N-Term)

Produktnummer ABIN631523

Produktdetails anti-PPP2R5A Antikörper

Target: PPP2R5A (Protein Phosphatase 2, Regulatory Subunit B' alpha (PPP2R5A))

Bindungsspezifität: N-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP2R5A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PPP2 R2 antibody was raised against the N terminal of PPP2 2

Aufreinigung: Affinity purified

Immunogen: PPP2 R2 antibody was raised using the N terminal of PPP2 2 corresponding to a region with amino acids YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP2R5A Blocking Peptide, ABIN936266, is also available for use as a blocking control in assays to test for specificity of this PPP2R5A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP2R5A

Target: PPP2R5A (Protein Phosphatase 2, Regulatory Subunit B' alpha (PPP2R5A))

Andere Bezeichnung: PPP2R5A (PPP2R5A Produkte)

Synonyme: PR61alpha antikoerper, B56A antikoerper, PR61A antikoerper, si:dkey-18c8.1 antikoerper, protein phosphatase 2 regulatory subunit B'alpha antikoerper, protein phosphatase 2, regulatory subunit B', alpha antikoerper, protein phosphatase 2 regulatory subunit B', alpha antikoerper, protein phosphatase 2, regulatory subunit B', alpha isoform antikoerper, PPP2R5A antikoerper, Ppp2r5a antikoerper, ppp2r5a.S antikoerper, ppp2r5a antikoerper

Hintergrund: PPP2R5A belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg