ACAA1 Antikörper
-
- Target Alle ACAA1 Antikörper anzeigen
- ACAA1 (Acetyl-CoA Acyltransferase 1 (ACAA1))
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACAA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD
- Top Product
- Discover our top product ACAA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACAA1 Blocking Peptide, catalog no. 33R-1110, is also available for use as a blocking control in assays to test for specificity of this ACAA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACAA1 (Acetyl-CoA Acyltransferase 1 (ACAA1))
- Andere Bezeichnung
- ACAA1 (ACAA1 Produkte)
- Synonyme
- ACAA antikoerper, PTHIO antikoerper, THIO antikoerper, Acaa antikoerper, Acaa1 antikoerper, D9Ertd25e antikoerper, PTL antikoerper, zgc:92385 antikoerper, acaa antikoerper, pthio antikoerper, thio antikoerper, A2MP antikoerper, Pktaa antikoerper, acetyl-CoA acyltransferase 1 antikoerper, acetyl-Coenzyme A acyltransferase 1A antikoerper, acetyl-CoA acyltransferase 1 L homeolog antikoerper, ACP synthase antikoerper, alpha-2-macroglobulin pseudogene 1 antikoerper, acetyl-CoA acyltransferase 1A antikoerper, ACAA1 antikoerper, Acaa1a antikoerper, acaa1.L antikoerper, acaa1 antikoerper, AF_RS00150 antikoerper, A2MP1 antikoerper, Acaa1 antikoerper
- Hintergrund
- ACAA1 is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-