NSUN3 Antikörper (C-Term)

Produktnummer ABIN631537

Produktdetails anti-NSUN3 Antikörper

Target: NSUN3 (NOP2/Sun Domain Family, Member 3 (NSUN3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NSUN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NSUN3 antibody was raised against the C terminal of NSUN3

Aufreinigung: Affinity purified

Immunogen: NSUN3 antibody was raised using the C terminal of NSUN3 corresponding to a region with amino acids LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NSUN3 Blocking Peptide, catalog no. 33R-5271, is also available for use as a blocking control in assays to test for specificity of this NSUN3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NSUN3

Target: NSUN3 (NOP2/Sun Domain Family, Member 3 (NSUN3))

Andere Bezeichnung: NSUN3 (NSUN3 Produkte)

Synonyme: 6720484A09Rik antikoerper, AU022521 antikoerper, MST077 antikoerper, im:7142194 antikoerper, zgc:109983 antikoerper, NOL1/NOP2/Sun domain family member 3 antikoerper, NOP2/Sun RNA methyltransferase family member 3 antikoerper, NOP2/Sun domain family, member 3 antikoerper, Nsun3 antikoerper, NSUN3 antikoerper, nsun3 antikoerper

Hintergrund: NSUN3 may have S-adenosyl-L-methionine-dependent methyl-transferase activity.

Molekulargewicht: 38 kDa (MW of target protein)