PWWP2A Antikörper (C-Term)
-
- Target Alle PWWP2A Produkte
- PWWP2A (PWWP Domain Containing 2A (PWWP2A))
- Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PWWP2A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PWWP2 A antibody was raised against the C terminal of PWWP2
- Aufreinigung
- Affinity purified
- Immunogen
- PWWP2 A antibody was raised using the C terminal of PWWP2 corresponding to a region with amino acids PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PWWP2A Blocking Peptide, catalog no. 33R-7313, is also available for use as a blocking control in assays to test for specificity of this PWWP2A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PWWP0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PWWP2A (PWWP Domain Containing 2A (PWWP2A))
- Andere Bezeichnung
- PWWP2A (PWWP2A Produkte)
- Hintergrund
- PWWP2A contains 1 PWWP domain. The exact function of PWWP2A remains unknown.
- Molekulargewicht
- 61 kDa (MW of target protein)
-