PWWP2B Antikörper (N-Term)

Produktnummer ABIN631542

Produktdetails anti-PWWP2B Antikörper

Target: PWWP2B (PWWP Domain Containing 2B (PWWP2B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PWWP2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PWWP2 B antibody was raised against the N terminal of PWWP2

Aufreinigung: Affinity purified

Immunogen: PWWP2 B antibody was raised using the N terminal of PWWP2 corresponding to a region with amino acids ILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQLGSSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PWWP2B Blocking Peptide, catalog no. 33R-4054, is also available for use as a blocking control in assays to test for specificity of this PWWP2B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PWWP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PWWP2B

Target: PWWP2B (PWWP Domain Containing 2B (PWWP2B))

Andere Bezeichnung: PWWP2B (PWWP2B Produkte)

Synonyme: PWWP2 antikoerper, RP11-273H7.1 antikoerper, bA432J24.1 antikoerper, pp8607 antikoerper, Pwwp2 antikoerper, AI594893 antikoerper, D7Ertd517e antikoerper, D930023J19Rik antikoerper, PWWP2B antikoerper, MGC140452 antikoerper, PWWP domain containing 2B antikoerper, PWWP2B antikoerper, Pwwp2b antikoerper

Hintergrund: The function of PWWP2B protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 53 kDa (MW of target protein)