METTL6 Antikörper (N-Term)

Produktnummer ABIN631546

Produktdetails anti-METTL6 Antikörper

Target: METTL6 (Methyltransferase Like 6 (METTL6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser METTL6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: METTL6 antibody was raised against the N terminal of METTL6

Aufreinigung: Affinity purified

Immunogen: METTL6 antibody was raised using the N terminal of METTL6 corresponding to a region with amino acids QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

METTL6 Blocking Peptide, catalog no. 33R-7606, is also available for use as a blocking control in assays to test for specificity of this METTL6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu METTL6

Target: METTL6 (Methyltransferase Like 6 (METTL6))

Andere Bezeichnung: METTL6 (METTL6 Produkte)

Synonyme: zgc:56175 antikoerper, zgc:76943 antikoerper, 1600013P15Rik antikoerper, AI467521 antikoerper, AU020711 antikoerper, methyltransferase like 6 antikoerper, methyltransferase like 6 L homeolog antikoerper, mettl6 antikoerper, mettl6.L antikoerper, METTL6 antikoerper, Mettl6 antikoerper

Hintergrund: METTL6 is a probable methyltransferase.

Molekulargewicht: 33 kDa (MW of target protein)