NSUN4 Antikörper (N-Term)

Produktnummer ABIN631550

Produktdetails anti-NSUN4 Antikörper

Target: NSUN4 (NOL1/NOP2/Sun Domain Family, Member 4 (NSUN4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NSUN4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NSUN4 antibody was raised against the N terminal of NSUN4

Aufreinigung: Affinity purified

Immunogen: NSUN4 antibody was raised using the N terminal of NSUN4 corresponding to a region with amino acids QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NSUN4 Blocking Peptide, catalog no. 33R-7616, is also available for use as a blocking control in assays to test for specificity of this NSUN4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NSUN4

Target: NSUN4 (NOL1/NOP2/Sun Domain Family, Member 4 (NSUN4))

Andere Bezeichnung: NSUN4 (NSUN4 Produkte)

Synonyme: 2310010O12Rik antikoerper, 2810405F18Rik antikoerper, AI507900 antikoerper, Shtap antikoerper, RP4-603I14.2 antikoerper, SHTAP antikoerper, RGD1559652 antikoerper, NOL1/NOP2/Sun domain family, member 4 antikoerper, NOP2/Sun RNA methyltransferase family member 4 antikoerper, NOP2/Sun RNA methyltransferase family member 4 S homeolog antikoerper, Nsun4 antikoerper, NSUN4 antikoerper, nsun4.S antikoerper

Hintergrund: NSUN4 may have S-adenosyl-L-methionine-dependent methyl-transferase activity.

Molekulargewicht: 43 kDa (MW of target protein)