POLQ Antikörper
-
- Target Alle POLQ Antikörper anzeigen
- POLQ (Polymerase (DNA Directed), theta (POLQ))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser POLQ Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- POLQ antibody was raised using a synthetic peptide corresponding to a region with amino acids SATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKEN
- Top Product
- Discover our top product POLQ Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
POLQ Blocking Peptide, catalog no. 33R-8319, is also available for use as a blocking control in assays to test for specificity of this POLQ antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLQ antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLQ (Polymerase (DNA Directed), theta (POLQ))
- Andere Bezeichnung
- POLQ (POLQ Produkte)
- Hintergrund
- POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.
- Molekulargewicht
- 180 kDa (MW of target protein)
-